PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc003467.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family FAR1
Protein Properties Length: 352aa    MW: 40345.9 Da    PI: 6.3243
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc003467.1_g00001.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR132.13.9e-103584151
                     FAR1  1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkkteke 51
                             +fY++YAk+vGF+vr  +++k+ r ge+  + +vCs+eg++   k+k++++
  Itr_sc003467.1_g00001.1 35 EFYKAYAKTVGFDVRHGTMRKT-RGGEVGIKYMVCSREGFKPIVKEKNSQK 84
                             6*****************9999.888899***********99887773322 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031013.9E-73585IPR004330FAR1 DNA binding domain
PfamPF105513.8E-1492145IPR018289MULE transposase domain
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MEISPNGTKQ WIPNANPEET PYTGQKFKTV DEGIEFYKAY AKTVGFDVRH GTMRKTRGGE  60
VGIKYMVCSR EGFKPIVKEK NSQKDVCTET KGDTDSYEWL LTSFKNAMGS TPRCAITDQD  120
AALRVAVPNI MPTTRHRFCM WHIMTKVGDK AGSVLARDKE FRKALNNVVW DETLSVEEFE  180
KRWQKVMEEY DLVEDRAIEE QRYKQSKLNA ECEGSFPEIK TPLHMEQQTT TLYTINMFYE  240
FQTDIWEGSF TCHIIHQRES MDAHTYTVQE KGGKAFEVTM STNDLGPPCD SIIAHGRACV  300
RPAFILIVFN KIVLTIIAAN VIALKQIELD RFRYRDQGTI TVNRDVVSEV EA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.16e-18FAR1-related sequence 5